Labrus mixtus (cuckoo wrasse): 132955893 Help Entry 132955893         CDS       T10666                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism lmix  Labrus mixtus (cuckoo wrasse) Pathway lmix04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:lmix00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     132955893  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lmix04121]     132955893    03400 DNA repair and recombination proteins [BR:lmix03400]     132955893 Ubiquitin system [BR:lmix04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      132955893    Cul5 complex      132955893 DNA repair and recombination proteins [BR:lmix03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      132955893 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  132955893 NCBI-ProteinID:  XP_060884962 LinkDB All DBs Position 21:12205137..12208749 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRTPEDQRLYKDDQLLEDSKTLGDS GFTNQTARPQAPATVGLAFRINDEMFEQLHVEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggacgtgttcttaatgatccggcgtcacaagactacaatcttcacagacgccaaagag tccactacggtctatgagctgaagcggattgttgaaggaatcctgaagagaactcctgaa gaccagaggctctacaaagatgaccagttgctagaggacagcaaaacgcttggtgatagt ggattcaccaaccagactgccagacctcaggccccagctacagttggtctggctttccgc ataaatgacgagatgttcgaacagctgcacgtcgaggccttctccagccccccagaactc cccgatgtgatgaaacctcaggactcgggtagcactgccaacgagcaggccgtgcagtga

DBGET integrated database retrieval system