Labrus mixtus (cuckoo wrasse): 132958830 Help Entry 132958830         CDS       T10666                                  Symbol cxcl19 Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism lmix  Labrus mixtus (cuckoo wrasse) Pathway lmix04060   Cytokine-cytokine receptor interaction lmix04218   Cellular senescence lmix04620   Toll-like receptor signaling pathway lmix04621   NOD-like receptor signaling pathway lmix04622   RIG-I-like receptor signaling pathway lmix05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lmix00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     132958830 (cxcl19)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     132958830 (cxcl19)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     132958830 (cxcl19)    04621 NOD-like receptor signaling pathway     132958830 (cxcl19)    04622 RIG-I-like receptor signaling pathway     132958830 (cxcl19)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132958830 (cxcl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lmix04052]     132958830 (cxcl19)    00536 Glycosaminoglycan binding proteins [BR:lmix00536]     132958830 (cxcl19) Cytokines and neuropeptides [BR:lmix04052]  Cytokines   Chemokines    132958830 (cxcl19) Glycosaminoglycan binding proteins [BR:lmix00536]  Heparan sulfate / Heparin   Chemokines    132958830 (cxcl19) SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  132958830 NCBI-ProteinID:  XP_060887881 LinkDB All DBs Position 23:15688678..15787684 Genome browser AA seq 105 aa AA seqDB search MKLCILLVLGTLTVLVNGMPPISRDYNTHCRCPQVESRIIPPDNLRSIKLVPEGPHCPET EVIAGLVSGEKVCLNPNSSWVKKLIHYVLEKQLHQQGVAVPKNRA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatcctgctggtgctcgggaccctgactgtcctcgttaacggtatgccg ccaatcagcagggactacaacacacactgtcggtgcccccaggtggagtcgaggatcatc cctccagacaacctgaggagcatcaagctcgtccccgaaggtccacactgccccgagaca gaagtcatagctggactcgtgagcggggagaaagtttgcctgaaccctaattcctcctgg gtgaagaagctgatccactatgttcttgagaaacagctacaccagcagggtgtggccgtt cctaagaacagagcatag

DBGET integrated database retrieval system