Labrus mixtus (cuckoo wrasse): 132973220 Help Entry 132973220         CDS       T10666                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism lmix  Labrus mixtus (cuckoo wrasse) Pathway lmix04010   MAPK signaling pathway lmix04012   ErbB signaling pathway lmix04068   FoxO signaling pathway lmix04137   Mitophagy - animal lmix04140   Autophagy - animal lmix04144   Endocytosis lmix04150   mTOR signaling pathway lmix04210   Apoptosis lmix04218   Cellular senescence lmix04370   VEGF signaling pathway lmix04371   Apelin signaling pathway lmix04510   Focal adhesion lmix04540   Gap junction lmix04625   C-type lectin receptor signaling pathway lmix04810   Regulation of actin cytoskeleton lmix04910   Insulin signaling pathway lmix04912   GnRH signaling pathway lmix04916   Melanogenesis lmix05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lmix00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132973220    04012 ErbB signaling pathway     132973220    04370 VEGF signaling pathway     132973220    04371 Apelin signaling pathway     132973220    04068 FoxO signaling pathway     132973220    04150 mTOR signaling pathway     132973220  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132973220    04140 Autophagy - animal     132973220    04137 Mitophagy - animal     132973220   09143 Cell growth and death    04210 Apoptosis     132973220    04218 Cellular senescence     132973220   09144 Cellular community - eukaryotes    04510 Focal adhesion     132973220    04540 Gap junction     132973220   09142 Cell motility    04810 Regulation of actin cytoskeleton     132973220  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132973220   09152 Endocrine system    04910 Insulin signaling pathway     132973220    04912 GnRH signaling pathway     132973220    04916 Melanogenesis     132973220  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132973220  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lmix04131]     132973220   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lmix04147]     132973220    04031 GTP-binding proteins [BR:lmix04031]     132973220 Membrane trafficking [BR:lmix04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     132973220  Endocytosis   Macropinocytosis    Ras GTPases     132973220 Exosome [BR:lmix04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    132973220   Exosomal proteins of colorectal cancer cells    132973220 GTP-binding proteins [BR:lmix04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132973220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  132973220 NCBI-ProteinID:  XP_060892536 LinkDB All DBs Position 4:complement(24291570..24307246) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagttggtggtggtgggagcaggaggcgtgggcaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccatagaggactcatac aggaagcaggttgtgattgacggggaaacctgcctgctggatatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgcggacaggggagggcttcctctgc gtcttcgctataaacaacaccaagtcttttgaggacattcatcagtacagggaacaaatt aaacgtgtaaaggactcagacgatgtacccatggtgcttgtgggaaacaaatgtgacctc cctgcacgcacggtggacacaaggcaagcccaggaactcgcccgatcttacggcattcct tatatcgagacctctgcaaagacacgacagggagtagaggacgccttctatacactggtt agggagataagacagcataagctgagaaagctgaacccacctgatgagagcggacaggac tgtatgagctgccgctgtgtggtatcgtga

DBGET integrated database retrieval system