Labrus mixtus (cuckoo wrasse): 132982454 Help Entry 132982454         CDS       T10666                                  Symbol insb Name (RefSeq) preproinsulin b   KO K04526   insulin Organism lmix  Labrus mixtus (cuckoo wrasse) Pathway lmix04010   MAPK signaling pathway lmix04068   FoxO signaling pathway lmix04081   Hormone signaling lmix04114   Oocyte meiosis lmix04140   Autophagy - animal lmix04150   mTOR signaling pathway lmix04810   Regulation of actin cytoskeleton lmix04910   Insulin signaling pathway lmix04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:lmix00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132982454 (insb)    04068 FoxO signaling pathway     132982454 (insb)    04150 mTOR signaling pathway     132982454 (insb)   09133 Signaling molecules and interaction    04081 Hormone signaling     132982454 (insb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132982454 (insb)   09143 Cell growth and death    04114 Oocyte meiosis     132982454 (insb)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132982454 (insb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     132982454 (insb)    04914 Progesterone-mediated oocyte maturation     132982454 (insb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lmix04052]     132982454 (insb) Cytokines and neuropeptides [BR:lmix04052]  Neuropeptides   Unclassified    132982454 (insb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Toxin_8 Motif Other DBs NCBI-GeneID:  132982454 NCBI-ProteinID:  XP_060904944 LinkDB All DBs Position 10:27544082..27546640 Genome browser AA seq 109 aa AA seqDB search MAGVSWAVSLLLLLALQPPMVSAIPAQHLCGSRLVDALYFVCGERGFFYSRNRPYKRDLD HLLGFLSKRARQEQQRPTEAHNEPKVKRGIVEQCCHRPCSVYHLEGYCD NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atggccggagtatcatgggcggtgtctctgctgttactactggcgctccagcctccgatg gtgtctgcaatccctgcccaacacctgtgtggctctcgcctggtcgatgccctctacttc gtttgcggagagcgaggctttttctacagtcgcaaccgaccctacaagcgggatttagat catctgctcgggttcctgtccaaaagggccagacaggagcagcagcggccgacggaggct cataacgagcccaaggtgaagagaggcatcgtggagcagtgctgccacaggccgtgcagc gtttaccacctggagggctactgcgactga

DBGET integrated database retrieval system