Labrus mixtus (cuckoo wrasse): 132983087 Help Entry 132983087         CDS       T10666                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism lmix  Labrus mixtus (cuckoo wrasse) Pathway lmix04010   MAPK signaling pathway lmix04144   Endocytosis lmix04370   VEGF signaling pathway lmix04510   Focal adhesion lmix04520   Adherens junction lmix04530   Tight junction lmix04810   Regulation of actin cytoskeleton lmix04912   GnRH signaling pathway lmix05100   Bacterial invasion of epithelial cells lmix05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lmix00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132983087 (cdc42l)    04370 VEGF signaling pathway     132983087 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     132983087 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     132983087 (cdc42l)    04520 Adherens junction     132983087 (cdc42l)    04530 Tight junction     132983087 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132983087 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     132983087 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     132983087 (cdc42l)    05100 Bacterial invasion of epithelial cells     132983087 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lmix04131]     132983087 (cdc42l)    03036 Chromosome and associated proteins [BR:lmix03036]     132983087 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lmix04147]     132983087 (cdc42l)    04031 GTP-binding proteins [BR:lmix04031]     132983087 (cdc42l) Membrane trafficking [BR:lmix04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     132983087 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     132983087 (cdc42l)   Macropinocytosis    Ras GTPases     132983087 (cdc42l) Chromosome and associated proteins [BR:lmix03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     132983087 (cdc42l) Exosome [BR:lmix04147]  Exosomal proteins   Exosomal proteins of microglial cells    132983087 (cdc42l)   Exosomal proteins of breast milk    132983087 (cdc42l) GTP-binding proteins [BR:lmix04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     132983087 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  132983087 NCBI-ProteinID:  XP_060905316 LinkDB All DBs Position 11:16320321..16325105 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPRVPFLLVGTQVDLR DDPNTTDKLAKNKQRPIGPEVGEKLGRDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ECKKKSKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtagtggtaggggacggtgctgtaggaaagacctgcctactg atctcctacacaaccaacaagttcccctcagaatatgtgccaacggtttttgacaattat gcggtgacggtgatgattggaggagagccctacacactcggactatttgacacagcaggt caggaggattatgacaggctgcgtcctctcagctatccacagactgatgtgttccttgta tgtttctctgtcgtctccccctcatcgtttgaaaacgtcaaagagaagtgggttcctgag ataactcaccactgcccacgtgtacctttcctcttagtgggcacacaggtggatctgagg gacgaccccaacacaactgacaagctggcaaagaacaaacagcgccctattgggcctgag gtcggagaaaagctaggccgtgaccttagggctgtcaaatacgtggagtgctctgctctg acacagcgagggcttaagaatgtgtttgatgaggcaatcctggccgccttggagcctccc gagtgcaaaaagaagagcaagtgtgtgctgctatag

DBGET integrated database retrieval system