Labrus mixtus (cuckoo wrasse): 132988002 Help Entry 132988002         CDS       T10666                                  Symbol hmgb1a Name (RefSeq) high mobility group protein B1a   KO K10802   high mobility group protein B1 Organism lmix  Labrus mixtus (cuckoo wrasse) Pathway lmix03410   Base excision repair lmix04140   Autophagy - animal lmix04217   Necroptosis Brite KEGG Orthology (KO) [BR:lmix00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     132988002 (hmgb1a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132988002 (hmgb1a)   09143 Cell growth and death    04217 Necroptosis     132988002 (hmgb1a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lmix03036]     132988002 (hmgb1a)    03400 DNA repair and recombination proteins [BR:lmix03400]     132988002 (hmgb1a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lmix04147]     132988002 (hmgb1a) Chromosome and associated proteins [BR:lmix03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     132988002 (hmgb1a) DNA repair and recombination proteins [BR:lmix03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      132988002 (hmgb1a)    MMR (mismatch excision repair)     Other MMR factors      132988002 (hmgb1a) Exosome [BR:lmix04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    132988002 (hmgb1a) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box HMG_box_2 HMG_WDHD1 HMG_box_5 Acidic_SOMP Motif Other DBs NCBI-GeneID:  132988002 NCBI-ProteinID:  XP_060911046 LinkDB All DBs Position 14:11039429..11043475 Genome browser AA seq 205 aa AA seqDB search MGKDPTKPRGKMSSYAYFVQTCREEHKKKHPEASVNFSEFSKKCSERWKTMSAKEKGKFE DLARQDKVRYEREMVNYVPARGAGKTKKFKDPNAPKRPPSAFFIFCADFRPKVKGESPGL TIGDVAKRLGEMWNGTSSEDKQPYEKKAAKLKEKYEKDVAAYRAKGKTGAAAPAKAPAKV EKKDDDDDDDDEEDDDDDDFDDDDD NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggggaaagatccgaccaagccgaggggcaagatgtcctcttatgcgtattttgtccag acctgtcgggaggagcacaagaagaaacaccctgaggcttctgtgaacttttccgagttc tccaagaagtgttctgagcgctggaagacaatgtctgccaaggagaagggcaagtttgag gacctggcaaggcaggacaaagtccgctatgagagggagatggtgaactacgtgcctgcc aggggagcaggcaagacgaagaagttcaaggaccccaatgcccccaagagacccccatcc gctttcttcatcttctgcgcagattttcgccctaaggtgaaaggtgagagccctggtctg accattggagatgttgccaagaggctgggcgagatgtggaacggcacctcttcagaggac aagcagccctacgagaagaaggccgctaaactgaaggagaagtatgagaaggatgttgca gcctatcgtgctaagggcaaaaccggcgctgcagcaccagcaaaagccccggccaaggtg gagaaaaaagacgacgacgacgacgatgatgatgaggaagacgatgacgacgacgacttc gatgatgatgatgattag

DBGET integrated database retrieval system