KEGG   Labrus mixtus (cuckoo wrasse): 132988171
Entry
132988171         CDS       T10666                                 
Symbol
skp1
Name
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
lmix  Labrus mixtus (cuckoo wrasse)
Pathway
lmix03083  Polycomb repressive complex
lmix04110  Cell cycle
lmix04114  Oocyte meiosis
lmix04120  Ubiquitin mediated proteolysis
lmix04141  Protein processing in endoplasmic reticulum
lmix04310  Wnt signaling pathway
lmix04350  TGF-beta signaling pathway
lmix05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:lmix00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    132988171 (skp1)
   04120 Ubiquitin mediated proteolysis
    132988171 (skp1)
  09126 Chromosome
   03083 Polycomb repressive complex
    132988171 (skp1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    132988171 (skp1)
   04350 TGF-beta signaling pathway
    132988171 (skp1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    132988171 (skp1)
   04114 Oocyte meiosis
    132988171 (skp1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    132988171 (skp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lmix04131]
    132988171 (skp1)
   04121 Ubiquitin system [BR:lmix04121]
    132988171 (skp1)
   03036 Chromosome and associated proteins [BR:lmix03036]
    132988171 (skp1)
Membrane trafficking [BR:lmix04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    132988171 (skp1)
Ubiquitin system [BR:lmix04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     132988171 (skp1)
   Cul7 complex
     132988171 (skp1)
Chromosome and associated proteins [BR:lmix03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     132988171 (skp1)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     132988171 (skp1)
SSDB
Motif
Pfam: Skp1 Skp1_POZ
Other DBs
NCBI-GeneID: 132988171
NCBI-ProteinID: XP_060911363
LinkDB
Position
14:complement(15714848..15720305)
AA seq 163 aa
MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgcccacgataaaattacagagctctgatggggaaatcttcgaggtcgatgttgagatc
gccaaacagtctgtcactattaagaccatgttagaagatttgggaatggacgatgaagga
gacgatgatccagttcccctccctaatgtgaatgcagccatccttaagaaggtgattcag
tggtgcactcatcacaaagatgaccctcctcctcctgaggatgatgagaacaaggagaaa
agaacagatgacattcctgtttgggaccaggagttcctcaaagtggaccaaggcaccttg
tttgaactcattctggccgccaactatttggacatcaaaggcctgttagatgtcacctgc
aagacggtggctaacatgatcaaaggcaaaaccccagaggagatcaggaagactttcaac
atcaaaaatgattttacagaggaggaggaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtaa

DBGET integrated database retrieval system