Labrus mixtus (cuckoo wrasse): 132988754 Help Entry 132988754         CDS       T10666                                  Name (RefSeq) histone H2B 1/2-like   KO K11252   histone H2B Organism lmix  Labrus mixtus (cuckoo wrasse) Brite KEGG Orthology (KO) [BR:lmix00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lmix03036]     132988754   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lmix04147]     132988754 Chromosome and associated proteins [BR:lmix03036]  Eukaryotic type   Nucleosome assembly factors    Histones     132988754 Exosome [BR:lmix04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    132988754 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  132988754 NCBI-ProteinID:  XP_060912309 LinkDB All DBs Position 14:29547567..29547900 Genome browser AA seq 89 aa AA seqDB search MPETVKAPKATKTGKNRRKTRKESYAIYVYKVLKQCIAGEASRLAYYNKRSTITSREIQT AVCLLLPGELAKHDVSEGTKAVTKYTTSK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaaccgtgaaagcgcccaaggccaccaagaccggcaaaaacagacgaaagacc aggaaggagagctacgctatctacgtctacaaggtcctgaagcagtgcatcgccggggag gcatcccgtctggcttactacaacaagcgctccaccatcacctccagagagatccagacc gccgtctgtctgctgctgcccggtgagctggccaaacacgacgtgtccgagggcaccaag gcagtgaccaagtacaccacctccaagtaa

DBGET integrated database retrieval system