Listeria monocytogenes NE dc2014: CQ02_10025 Help Entry CQ02_10025        CDS       T03477                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism lmok  Listeria monocytogenes NE dc2014 Brite KEGG Orthology (KO) [BR:lmok00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lmok03032]     CQ02_10025    03036 Chromosome and associated proteins [BR:lmok03036]     CQ02_10025    03400 DNA repair and recombination proteins [BR:lmok03400]     CQ02_10025 DNA replication proteins [BR:lmok03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CQ02_10025 Chromosome and associated proteins [BR:lmok03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CQ02_10025 DNA repair and recombination proteins [BR:lmok03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CQ02_10025 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AHN33178 UniProt:  L8E1Q8 LinkDB All DBs Position complement(1988932..1989207) Genome browser AA seq 91 aa AA seqDB search MANKTDLVNSVAELADLSKKDAAKAVEAVFETIQTSLSKGEKVQLIGFGNFEVRERAARK GRNPRTKEEIDIPASKVPAFKPGKALKEAVK NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcaaataaaactgatttagtaaatagcgttgctgaactagctgatctttctaaaaaa gacgcagcgaaagcagtagaagctgtattcgaaactattcaaacttctttatctaaaggt gaaaaagttcaattaatcggatttggtaactttgaagtacgtgaacgtgctgcccgtaaa ggtcgtaaccctcgtactaaagaagaaatcgacatccctgcaagtaaagtaccagctttc aaacctggtaaagcgcttaaagaagctgttaaataa

DBGET integrated database retrieval system