KEGG   Listeria monocytogenes Lm60 (serotype 1/2a): IJ09_14950
Entry
IJ09_14950        CDS       T03479                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
lmom  Listeria monocytogenes Lm60 (serotype 1/2a)
Pathway
lmom00770  Pantothenate and CoA biosynthesis
lmom01100  Metabolic pathways
lmom01240  Biosynthesis of cofactors
Module
lmom_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:lmom00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    IJ09_14950 (coaD)
Enzymes [BR:lmom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     IJ09_14950 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AIL69014
UniProt: A0A9P3QK36
LinkDB
Position
2892674..2893156
AA seq 160 aa
MGDKIAVIPGTFDPITNGHLDIIERAAKIFDLLYVSVLNNSSKKPLFTIEERMEMIRQVT
AHLPNVQVESASGLTVDYAATRGATAIVRGLRAVSDFEYEMQIASMNRTLNADIETFFVM
TNTKYSFLSSSMVKEVAQYQGDISELVPEIVNEQVQAKFK
NT seq 483 nt   +upstreamnt  +downstreamnt
atgggtgacaaaattgccgttattcccgggacatttgatccgattacgaatggtcactta
gatattattgaacgtgcagcgaagattttcgatttgttatatgtttccgttttaaacaat
tcatccaaaaaaccacttttcacgatagaagagagaatggaaatgattagacaagtaacc
gctcatttgccaaatgttcaagtggaaagtgcgagcggattgactgttgattatgctgct
acacgcggtgctacggcaattgtcagaggacttcgagcggtgagtgattttgaatacgag
atgcaaattgcttcgatgaaccgaacactaaatgcggatatcgaaactttttttgtcatg
actaatacgaaatattcttttttaagttcaagtatggtaaaagaagtggcgcagtatcaa
ggcgatatcagcgaacttgtgccagaaatcgtgaacgaacaagtacaagcaaaatttaag
taa

DBGET integrated database retrieval system