KEGG   Listeria monocytogenes SLCC7179 (serotype 3a): LMOSLCC7179_2586
Entry
LMOSLCC7179_2586  CDS       T02224                                 
Name
(GenBank) similar to ribosomal protein L18 RplR, C-terminal part
  KO
K02881  large subunit ribosomal protein L18
Organism
lmos  Listeria monocytogenes SLCC7179 (serotype 3a)
Pathway
lmos03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lmos00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LMOSLCC7179_2586
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lmos03011]
    LMOSLCC7179_2586
Ribosome [BR:lmos03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LMOSLCC7179_2586
  Bacteria
    LMOSLCC7179_2586
  Archaea
    LMOSLCC7179_2586
SSDB
Motif
Pfam: Ribosomal_L18p DUF7159
Other DBs
NCBI-ProteinID: CBY61792
LinkDB
Position
complement(2637843..2638052)
AA seq 69 aa
MTLASASNLDKDFGSAESKVDAASKVGELVAKRASEKGITSVTFDRGGYLYHGRVKALAE
AARENGLEF
NT seq 210 nt   +upstreamnt  +downstreamnt
gtgacacttgcaagtgcgtctaatttagataaagatttcggttctgctgaatccaaagtt
gatgcagcaagcaaagttggcgaactagttgctaaacgtgcttccgaaaaaggtattact
tctgtcacttttgaccgtggaggatacttatatcatggccgcgtgaaagctcttgctgaa
gcagctcgcgaaaatggactagaattttaa

DBGET integrated database retrieval system