Ligilactobacillus murinus: CPS94_04205 Help Entry CPS94_04205       CDS       T07549                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism lmur  Ligilactobacillus murinus Pathway lmur01100   Metabolic pathways lmur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:lmur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CPS94_04205 (acpP)    00074 Mycolic acid biosynthesis     CPS94_04205 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CPS94_04205 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 RIH_assoc DUF6315 Motif Other DBs NCBI-ProteinID:  AWZ38189 UniProt:  A0A2Z4VZ24 LinkDB All DBs Position complement(841017..841259) Genome browser AA seq 80 aa AA seqDB search MTENEIFTKITTIIEDHFDVSADKVTEQTNFKTDLDADSIDLVEFVLELEDAFGAEISDE DAEQIVTVKDAVDYIASHQG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacagaaaacgaaatttttacaaaaatcacaacaattattgaggatcactttgatgtt tcagctgataaagtgacagaacaaacaaactttaagacagatcttgatgccgattcgatc gatctggtggagtttgttttggaattagaagatgcttttggtgctgaaatttctgacgaa gacgccgaacaaatcgtgacagttaaagatgctgtagattatatcgcttcacatcaagga tag

DBGET integrated database retrieval system