Lagopus muta (rock ptarmigan): 125684092 Help Entry 125684092         CDS       T09141                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut04010   MAPK signaling pathway lmut04012   ErbB signaling pathway lmut04068   FoxO signaling pathway lmut04137   Mitophagy - animal lmut04140   Autophagy - animal lmut04150   mTOR signaling pathway lmut04210   Apoptosis lmut04218   Cellular senescence lmut04370   VEGF signaling pathway lmut04371   Apelin signaling pathway lmut04540   Gap junction lmut04625   C-type lectin receptor signaling pathway lmut04810   Regulation of actin cytoskeleton lmut04910   Insulin signaling pathway lmut04912   GnRH signaling pathway lmut04916   Melanogenesis Brite KEGG Orthology (KO) [BR:lmut00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125684092 (NRAS)    04012 ErbB signaling pathway     125684092 (NRAS)    04370 VEGF signaling pathway     125684092 (NRAS)    04371 Apelin signaling pathway     125684092 (NRAS)    04068 FoxO signaling pathway     125684092 (NRAS)    04150 mTOR signaling pathway     125684092 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125684092 (NRAS)    04137 Mitophagy - animal     125684092 (NRAS)   09143 Cell growth and death    04210 Apoptosis     125684092 (NRAS)    04218 Cellular senescence     125684092 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     125684092 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     125684092 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     125684092 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     125684092 (NRAS)    04912 GnRH signaling pathway     125684092 (NRAS)    04916 Melanogenesis     125684092 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lmut04131]     125684092 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lmut04147]     125684092 (NRAS)    04031 GTP-binding proteins [BR:lmut04031]     125684092 (NRAS) Membrane trafficking [BR:lmut04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     125684092 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     125684092 (NRAS) Exosome [BR:lmut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125684092 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    125684092 (NRAS)   Exosomal proteins of breast cancer cells    125684092 (NRAS)   Exosomal proteins of colorectal cancer cells    125684092 (NRAS) GTP-binding proteins [BR:lmut04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     125684092 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  125684092 NCBI-ProteinID:  XP_048781783 LinkDB All DBs Position 24:complement(3906906..3913233) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSNEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatacaagctggtggtggtgggagctggcggcgtcgggaagagcgcgttgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggattcgtac agaaagcaggttgtcattgatggagagacgtgcttgttagatattctggacactgcagga caggaagaatacagtgctatgcgagatcagtacatgagaactggggaaggattcctgtgt gtgtttgccattaacaacagtaaatcatttgctgatattaacctttacagagagcaaatc aagagagtgaaagattcagacgatgtgccgatggtgctggttgggaataagtgtgatttg cccacgaggacagtagacacaaaacaggctcaagaattagcaaaaagttatggcattccc ttcatagagacatcagctaaaacgagacagggtgtggaagatgcattttacacactggtg agagagattcggcagtaccggatgaaaaagctcaacagcaatgaagatgggaatcaaggc tgtatggggttgtcttgcattgtgatgtga

DBGET integrated database retrieval system