Lagopus muta (rock ptarmigan): 125685672 Help Entry 125685672         CDS       T09141                                  Symbol S100A10 Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut04382   Cornified envelope formation lmut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lmut00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     125685672 (S100A10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125685672 (S100A10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lmut04147]     125685672 (S100A10) Exosome [BR:lmut04147]  Exosomal proteins   Exosomal proteins of microglial cells    125685672 (S100A10) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  125685672 NCBI-ProteinID:  XP_048784903 LinkDB All DBs Position 29:986672..988725 Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETLMFTFHKYAGDKNYLSKEDLRALMEKEFPGFLENQRDPMALDKIMKDLD QCRDGKVGFQSFFSLVAGLTIACNDYFVVHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtcccagatggagcacgccatggagacgctgatgttcaccttccacaaatatgcg ggtgacaagaactacctgagcaaggaggacctgcgtgcactgatggagaaggagttccct ggattcctggagaaccagcgtgatcccatggctctggataagatcatgaaggacctggac cagtgccgggatggcaaagtaggcttccagagcttcttctcgctggtggccggactgacc atcgcctgcaacgactacttcgtggtgcacatgaagcagaaggggaggaagtga

DBGET integrated database retrieval system