Lagopus muta (rock ptarmigan): 125687373 Help Entry 125687373         CDS       T09141                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut04621   NOD-like receptor signaling pathway lmut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lmut00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125687373  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125687373  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:lmut03110]     125687373 Chaperones and folding catalysts [BR:lmut03110]  Protein folding catalysts   Protein disulfide isomerase    125687373 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 AhpC-TSA Thioredoxin_2 DIM1 OST3_OST6 Glutaredoxin Thioredoxin_7 Thioredoxin_9 Redoxin Motif Other DBs NCBI-GeneID:  125687373 NCBI-ProteinID:  XP_048788449 LinkDB All DBs Position Z:70529439..70534737 Genome browser AA seq 105 aa AA seqDB search MVKSVGSLSEFEAELKSAGEKLVVVDFSATWCGPCKMIKPFFHSLCDKFGDVVFIEIDVD DAQDVATHCDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagagcgtgggcagcctgtccgaattcgaggcagaactgaagtctgctggtgag aagcttgtagtagttgatttctctgccacatggtgtggaccatgcaaaatgatcaagcca tttttccatagtttgtgtgacaagtttggtgatgtggtgttcattgaaattgatgtggac gatgcccaggatgttgctacacactgtgatgtgaagtgcatgccaacattccagttctac aagaatggaaagaaggtgcaggaattctctggggccaataaggagaagctggaagagacc attaaaagtctaatctaa

DBGET integrated database retrieval system