Lagopus muta (rock ptarmigan): 125689445 Help Entry 125689445         CDS       T09141                                  Symbol UCN Name (RefSeq) urocortin   KO K23142   urocortin Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut04080   Neuroactive ligand-receptor interaction lmut04081   Hormone signaling Brite KEGG Orthology (KO) [BR:lmut00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     125689445 (UCN)    04081 Hormone signaling     125689445 (UCN)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lmut04052]     125689445 (UCN) Cytokines and neuropeptides [BR:lmut04052]  Neuropeptides   GPCR binding    125689445 (UCN) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CRF Motif Other DBs NCBI-GeneID:  125689445 NCBI-ProteinID:  XP_048792513 LinkDB All DBs Position 2:6537718..6538431 Genome browser AA seq 103 aa AA seqDB search MRRALLTVLLLLCRPFPAAPRPARPDGPDGPDVPGSGIPAAEGRSEALWPPLPAEPWRAR RDDPPLSIDLTFHLLRHLLLLARAQSERARADTNRRILDAVGR NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgcggcgggcgctgctcaccgttctgctgctgctgtgccgcccgttccccgccgccccc cgccccgcccgccccgacggccccgacggtcccgacgtccccggttcggggatccccgcg gcggaggggaggtccgaagcactgtggccgccgctgcccgcggagccgtggagggcgagg agggacgacccgccgctttccatcgacctcacgttccatcttctgcggcacctcctgctg ctcgcccgcgcacagagcgagcgcgcccgcgccgacaccaaccgccgcatcctcgacgcc gtgggacgctga

DBGET integrated database retrieval system