Lagopus muta (rock ptarmigan): 125690159 Help Entry 125690159         CDS       T09141                                  Name (RefSeq) histone H2A-IV   KO K11251   histone H2A Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut03082   ATP-dependent chromatin remodeling lmut04217   Necroptosis Brite KEGG Orthology (KO) [BR:lmut00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     125690159  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125690159  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:lmut03036]     125690159   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lmut04147]     125690159 Chromosome and associated proteins [BR:lmut03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125690159 Exosome [BR:lmut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125690159 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  125690159 NCBI-ProteinID:  XP_048794221 LinkDB All DBs Position 1:47402670..47403073 Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TDSHKAKAK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggccgcgggaagcagggcgggaaggcgcgcgccaaggccaagtcgcgctcgtcg cgggccgggctgcagttccccgtgggccgtgtgcaccggctgctgcgcaaaggcaactac gcggagcgggtgggcgccggcgccccggtgtacctggcggccgtgctggagtacctgacg gccgagatcctggagctggcgggcaacgcggcccgcgacaacaagaagacgcgcatcatc cctcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaag gtcaccatcgcgcagggcggggtgctgcccaacatccaggccgtgctgctgcccaagaaa accgacagccacaaggctaaggccaagtga

DBGET integrated database retrieval system