Lagopus muta (rock ptarmigan): 125692349 Help Entry 125692349         CDS       T09141                                  Name (RefSeq) interleukin-8   KO K10030   interleukin 8 Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut04060   Cytokine-cytokine receptor interaction lmut04218   Cellular senescence lmut04620   Toll-like receptor signaling pathway lmut04621   NOD-like receptor signaling pathway lmut04622   RIG-I-like receptor signaling pathway lmut05132   Salmonella infection lmut05164   Influenza A Brite KEGG Orthology (KO) [BR:lmut00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125692349  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     125692349  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125692349    04621 NOD-like receptor signaling pathway     125692349    04622 RIG-I-like receptor signaling pathway     125692349  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     125692349   09171 Infectious disease: bacterial    05132 Salmonella infection     125692349  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lmut04052]     125692349    00536 Glycosaminoglycan binding proteins [BR:lmut00536]     125692349 Cytokines and neuropeptides [BR:lmut04052]  Cytokines   Chemokines    125692349 Glycosaminoglycan binding proteins [BR:lmut00536]  Heparan sulfate / Heparin   Chemokines    125692349 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Ig_J_chain Motif Other DBs NCBI-GeneID:  125692349 NCBI-ProteinID:  XP_048798698 LinkDB All DBs Position 4:31405025..31408776 Genome browser AA seq 103 aa AA seqDB search MNGKLGAVLALLLVSAALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHC KNVEIIATLKDRREVCLDPTAPWVQLIVKALMAKAQLNSDAPL NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgaacggcaagcttggagcagtcctggctctcctcctggtttcagcagctctgtcgcaa ggtaggaccctggtaaagatggggaacgagctccggtgccagtgcattagcactcattct aagttcatccaccctaaatccattcaagatgtgaagctgacgccgagcggcccccactgc aagaacgttgaaatcatagctactctaaaggacagaagagaagtgtgcttggaccccact gctccctgggtacagctgatcgtaaaggcacttatggccaaggctcagctcaattctgat gcaccactgtga

DBGET integrated database retrieval system