Lagopus muta (rock ptarmigan): 125695229 Help Entry 125695229         CDS       T09141                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut04010   MAPK signaling pathway lmut04068   FoxO signaling pathway lmut04081   Hormone signaling lmut04114   Oocyte meiosis lmut04140   Autophagy - animal lmut04150   mTOR signaling pathway lmut04810   Regulation of actin cytoskeleton lmut04910   Insulin signaling pathway lmut04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:lmut00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125695229 (INS)    04068 FoxO signaling pathway     125695229 (INS)    04150 mTOR signaling pathway     125695229 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     125695229 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125695229 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     125695229 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     125695229 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     125695229 (INS)    04914 Progesterone-mediated oocyte maturation     125695229 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lmut04052]     125695229 (INS) Cytokines and neuropeptides [BR:lmut04052]  Neuropeptides   Unclassified    125695229 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  125695229 NCBI-ProteinID:  XP_048805379 LinkDB All DBs Position 6:13679895..13683547 Genome browser AA seq 107 aa AA seqDB search MALWIRSLPLLALLVFSGPRTSYAAANQHLCGSHLVEALYLVCGERGFFYSPKVRRDVEQ PLVSSPLRGEAGVLPFQQEEYEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcactgcctcttctggccctccttgttttttctggccctagg accagctatgcagctgccaaccagcacctctgtggctcccacttggtggaggctctctat ctggtgtgtggagagcgtggcttcttctactcccccaaagtccgacgggatgtcgagcag cctctagtgagcagtcccctccgtggtgaggcaggagtgctgcccttccagcaggaggaa tacgagaaggtcaagcgagggattgttgagcaatgctgccataatacatgttccctctac caattggagaactactgcaactag

DBGET integrated database retrieval system