Lagopus muta (rock ptarmigan): 125699000 Help Entry 125699000         CDS       T09141                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut04081   Hormone signaling lmut04144   Endocytosis lmut04150   mTOR signaling pathway lmut04270   Vascular smooth muscle contraction lmut04310   Wnt signaling pathway lmut04350   TGF-beta signaling pathway lmut04510   Focal adhesion lmut04517   IgSF CAM signaling lmut04519   Cadherin signaling lmut04520   Adherens junction lmut04530   Tight junction lmut04621   NOD-like receptor signaling pathway lmut04625   C-type lectin receptor signaling pathway lmut04810   Regulation of actin cytoskeleton lmut05100   Bacterial invasion of epithelial cells lmut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lmut00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     125699000 (RHOA)    04350 TGF-beta signaling pathway     125699000 (RHOA)    04150 mTOR signaling pathway     125699000 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     125699000 (RHOA)    04517 IgSF CAM signaling     125699000 (RHOA)    04519 Cadherin signaling     125699000 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125699000 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     125699000 (RHOA)    04520 Adherens junction     125699000 (RHOA)    04530 Tight junction     125699000 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     125699000 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125699000 (RHOA)    04625 C-type lectin receptor signaling pathway     125699000 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     125699000 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125699000 (RHOA)    05100 Bacterial invasion of epithelial cells     125699000 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lmut04131]     125699000 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lmut04147]     125699000 (RHOA)    04031 GTP-binding proteins [BR:lmut04031]     125699000 (RHOA) Membrane trafficking [BR:lmut04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     125699000 (RHOA) Exosome [BR:lmut04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125699000 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    125699000 (RHOA)   Exosomal proteins of colorectal cancer cells    125699000 (RHOA)   Exosomal proteins of bladder cancer cells    125699000 (RHOA) GTP-binding proteins [BR:lmut04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     125699000 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  125699000 NCBI-ProteinID:  XP_048813991 LinkDB All DBs Position 11:2339430..2358047 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggtgacggtgcctgtgggaagacctgc ctgctgattgtgtttagcaaagaccagttccctgaagtctatgttcccaccgtcttcgaa aattatgtagcagatattgaagtggatggaaagcaggtggagctggctctgtgggacaca gcaggacaagaagactacgatcgacttagaccgctttcttacccagacaccgacgttata cttatgtgtttttcaatcgatagtcctgatagtttagaaaacatcccagagaagtggacc ccagaggtgaagcatttctgtcccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaag cctgaggaaggaagagatatggcaaaccgcatcggtgcatttggatacatggagtgttcg gcaaagaccaaagacggtgtgagggaggtttttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaaaaagtccgggtgccttctcttataa

DBGET integrated database retrieval system