Lagopus muta (rock ptarmigan): 125699001 Help Entry 125699001         CDS       T09141                                  Symbol BRK1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut04810   Regulation of actin cytoskeleton lmut05132   Salmonella infection Brite KEGG Orthology (KO) [BR:lmut00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125699001 (BRK1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125699001 (BRK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind LXG Motif Other DBs NCBI-GeneID:  125699001 NCBI-ProteinID:  XP_048813992 LinkDB All DBs Position 11:2446271..2446998 Genome browser AA seq 75 aa AA seqDB search MSVQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgtcggtgcaggaggacccggtgcagcgagagatccaccaggactgggccaaccgcgag tacatcgaggtgatcaccagctccatcaagaagatcgccgacttcctcaactccttcgac atgtcgtgccgctcccgcctggccacgctgaacgagaagctgacggcgctggagcgcagg atcgagtacatcgaggcgcgggtcaccaagggcgagacgctgacgtag

DBGET integrated database retrieval system