Lagopus muta (rock ptarmigan): 31079470 Help Entry 31079470          CDS       T09141                                  Symbol ND4L, B2L67_mgp05 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut00190   Oxidative phosphorylation lmut01100   Metabolic pathways Module lmut_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:lmut00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     31079470 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:lmut03029]     31079470 (ND4L) Enzymes [BR:lmut01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      31079470 (ND4L) Mitochondrial biogenesis [BR:lmut03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     31079470 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 DUF5976 Motif Other DBs NCBI-GeneID:  31079470 NCBI-ProteinID:  YP_009350024 UniProt:  A0A1Q1N9Q4 LinkDB All DBs Position MT:11102..11398 Genome browser AA seq 98 aa AA seqDB search MSPLHFSFYSAFTFSSLGLAFHRTHLISALLCLESMMLSMFIPLSIWSIENQTPSFTLVP ILMLAFSACEAGTGLAMLVASTRTHGSDHLHNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctcctttacatttcagcttttactccgcattcacattcagcagcctaggattagca tttcaccgaacccaccttatctccgcccttctatgtttagagagcataatactgtctata tttatccctctctcaatttgatccatcgaaaaccaaaccccatcattcacccttgtgcca atcctaatactagctttctcagcatgcgaagctggtaccggcctagccatactagtagcc tcaacccgaacccacggctccgaccacttacacaacctcaacctcctacaatgttaa

DBGET integrated database retrieval system