Enterobacter sp. SGAir0187: CWR52_03835 Help Entry CWR52_03835       CDS       T05333                                  Name (GenBank) DNA damage-inducible protein I   KO K12149   DNA-damage-inducible protein I Organism lni  Enterobacter sp. SGAir0187 Brite KEGG Orthology (KO) [BR:lni00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:lni03400]     CWR52_03835 DNA repair and recombination proteins [BR:lni03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Other SOS response factors     CWR52_03835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DinI DUF2397 Motif Other DBs NCBI-ProteinID:  AVH16374 LinkDB All DBs Position 791219..791464 Genome browser AA seq 81 aa AA seqDB search MRIEITIAKTTVLPAGALDALAGELSRRINNTFPDNAGAVTVRYAAANNLSVIGAAKEDK DRISEILQETWESADDWFITD NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcgtattgaaatcaccatagccaaaactaccgttctgcctgccggcgcgcttgatgcc ctggcaggcgaattatcccgtcgtattaacaatacctttcctgacaacgcaggtgccgtc acggtgcgttacgccgcggcaaacaacctttccgttattggtgccgcaaaagaagataaa gatcgcatcagcgaaatcctgcaggaaacatgggaaagcgctgacgactggttcatcacg gattaa

DBGET integrated database retrieval system