KEGG   Enterobacter sp. SGAir0187: CWR52_06590
Entry
CWR52_06590       CDS       T05333                                 
Symbol
alsS
Name
(GenBank) acetolactate synthase AlsS
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
lni  Enterobacter sp. SGAir0187
Pathway
lni00290  Valine, leucine and isoleucine biosynthesis
lni00650  Butanoate metabolism
lni00660  C5-Branched dibasic acid metabolism
lni00770  Pantothenate and CoA biosynthesis
lni01100  Metabolic pathways
lni01110  Biosynthesis of secondary metabolites
lni01210  2-Oxocarboxylic acid metabolism
lni01230  Biosynthesis of amino acids
Module
lni_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
lni_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:lni00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CWR52_06590 (alsS)
   00660 C5-Branched dibasic acid metabolism
    CWR52_06590 (alsS)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    CWR52_06590 (alsS)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    CWR52_06590 (alsS)
Enzymes [BR:lni01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     CWR52_06590 (alsS)
SSDB
Motif
Pfam: TPP_enzyme_C TPP_enzyme_N TPP_enzyme_M CO_dh MACPF_b-prism
Other DBs
NCBI-ProteinID: AVH16883
LinkDB
Position
complement(1350016..1351695)
AA seq 559 aa
MNSEKQSRQWAHGADLVVGQLEAQGVKQVFGIPGAKIDKVFDSLLDSSIEIIPVRHEANA
AFMAAAVGRLTGKAGVALVTSGPGCSNLITGIATANSEGDPVVALGGAVKRADKAKLVHQ
SMDTVAMFSPVTKYAVEVSAPDAIAEVVSNAFRAAEHGRPGGAFVSLPQDIVDQPAMGAI
LPASGPALMGPAPESAINDVAKLIEKAKNPVILLGLMASQPANSAALRKLLEKSRIPVTS
TYQAAGAVNQEHFTRFAGRVGLFNNQAGDRLLHLADLIICIGYSPVEYEPSMWNSGDATL
VHIDVLPAYEERNYVPDLELVGDIAETLNQLANRIDHKLELSQRASEILVDRQHQRDLLD
RRGASLNQFALHPLRIVRAMQDIVNNDVTLTVDMGSFHIWIARYLYSFRARQVMISNGQQ
TMGVALPWAIGAWLVNPSRKVVSVSGDGGFLQSSMELETAVRLNANVLHIIWVDNGYNMV
AIQEEKKYQRLSGVEFGPVDFKVYADAFGAKGFAVESADALEPTLRAAMDVDGPAVVAIP
VDYSDNPLLMGQLHLSQIL
NT seq 1680 nt   +upstreamnt  +downstreamnt
gtgaacagtgagaaacagtcacgtcagtgggcgcacggcgccgatttggttgtcggccag
ctggaagcgcagggcgtgaagcaggtgttcgggatcccgggggcgaaaatcgacaaggtc
tttgattccctgctggactcctccatcgagattattccggtgcgccacgaggccaacgcg
gcgtttatggcggcggcggtcgggcgtctgaccggcaaggccggggtggcgctggtcacc
tccgggccgggctgctcgaacctgatcaccggcatcgccaccgccaacagcgagggcgac
ccggtggtggcgctgggcggggcggtgaagcgggcggataaagccaaactggtgcaccag
agcatggacaccgtcgccatgttcagcccggtcaccaaatacgccgtggaggtgagtgcg
ccggacgcgattgctgaggtggtttccaacgcgtttcgcgccgctgagcacggcaggccg
gggggcgcgtttgttagcctgccgcaggacattgtcgatcagcccgccatgggggcgatt
ttacccgccagcggtcccgcgctgatgggcccggcaccggaatccgccattaacgacgtg
gcgaagcttatcgaaaaggccaaaaacccggtcatcttgctggggctaatggcgagccag
cccgccaacagcgccgcgctgcgaaagctgctggagaaaagccgcattccggtgaccagc
acctatcaggccgccggggcggtgaatcaggagcacttcacccgcttcgccggacgcgtc
ggcctgttcaataaccaggcgggcgaccgtctgctgcatctggcggatctgattatctgc
atcggctacagcccggtggagtacgagccgtccatgtggaacagcggcgacgccacgctg
gtgcacattgacgtgctgcctgcctatgaagaacgtaactacgtcccggatctggagctg
gtgggggacatcgccgaaaccctgaatcagctcgctaaccgtatcgaccataagctggag
ctaagccagcgggcctccgaaattctggtcgatcgccagcatcagcgggacctcctcgac
cgacgcggcgcctcgcttaaccagtttgccctgcatccgctgcgcatcgtgcgcgccatg
caggacatcgtgaataacgacgtgacgctcaccgtggatatgggcagcttccatatctgg
atcgcccgctacctctacagtttccgggcgcgtcaggtgatgatctccaacggccagcag
accatgggcgtcgcgctgccgtgggcgattggcgcgtggctggtcaacccgagccgcaag
gtggtgtcggtctccggtgacggcggcttcctgcagtcaagcatggagctggaaaccgcg
gtgcgcctcaacgctaacgtgctgcacatcatctgggtggataacggctacaacatggtt
gccattcaggaagagaaaaaataccagcgtctttccggcgtcgagttcggcccggtcgat
ttcaaagtctatgccgacgcctttggcgcgaaaggctttgccgtggagagcgccgacgcg
ctcgaacccacgctgcgtgcggcgatggatgtggatggcccggccgtggtggccattccc
gtcgactacagcgataacccgctgctgatgggccagctccatctcagccagattttgtga

DBGET integrated database retrieval system