Lacinutrix neustonica: N7U66_05875 Help Entry N7U66_05875       CDS       T09391                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism lnu  Lacinutrix neustonica Brite KEGG Orthology (KO) [BR:lnu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:lnu03032]     N7U66_05875    03036 Chromosome and associated proteins [BR:lnu03036]     N7U66_05875    03400 DNA repair and recombination proteins [BR:lnu03400]     N7U66_05875 DNA replication proteins [BR:lnu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     N7U66_05875 Chromosome and associated proteins [BR:lnu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     N7U66_05875 DNA repair and recombination proteins [BR:lnu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       N7U66_05875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG 2-Hacid_dh HU-DNA_bdg ACP_syn_III_C Motif Other DBs NCBI-ProteinID:  WAC03141 UniProt:  A0A9E8SEF1 LinkDB All DBs Position 1061927..1062199 Genome browser AA seq 90 aa AA seqDB search MNKTDLIDAMAEHAGITKAASKKALECALIEIEGALQKGDRVSLVGFGSWSVSKRAARDG RNPQTGKTIKIKAKNVVKFKAGSDLSSAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagatttaatcgatgctatggcagaacacgcaggaattactaaagcagct tcaaaaaaagctttagaatgtgcgttaattgaaattgaaggcgctttacaaaaaggtgac agagtttcattagtaggattcggttcttggtcagtttctaaaagagctgcaagagatgga agaaacccacaaactggaaaaacaatcaaaatcaaagcgaagaacgttgttaagtttaaa gctggatctgatttatcaagtgctgtaaactaa

DBGET integrated database retrieval system