Loa loa (eye worm): LOAG_00477 Help Entry LOAG_00477        CDS       T02664                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism loa  Loa loa (eye worm) Pathway loa03020   RNA polymerase loa03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:loa00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     LOAG_00477   09124 Replication and repair    03420 Nucleotide excision repair     LOAG_00477  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:loa03021]     LOAG_00477    03400 DNA repair and recombination proteins [BR:loa03400]     LOAG_00477 Transcription machinery [BR:loa03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      LOAG_00477   RNA polymerase III system    RNA polymerase III      LOAG_00477   RNA polymerase I system    RNA polymerase I      LOAG_00477 DNA repair and recombination proteins [BR:loa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       LOAG_00477 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  9937845 NCBI-ProteinID:  XP_003136065 UniProt:  A0A1S0UBW6 LinkDB All DBs AA seq 74 aa AA seqDB search MLTWDCCKQNIQKASNSAFQIFGFSILLEVVKAVILFSGDALDALNLRRYCCRRMLLSHV DLIVKLLDYHPLEK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgcttacctgggattgctgcaagcagaatattcagaaggctagtaattcagcatttcag atttttggattcagtatattattggaagttgtgaaggcggtgatcttattcagtggtgat gctctcgatgcattaaatttacgccgttattgttgccgaagaatgcttctgtcacatgtt gatttaattgtcaagctgctcgattatcatcctttagagaaatga

DBGET integrated database retrieval system