Loa loa (eye worm): LOAG_04017 Help Entry LOAG_04017        CDS       T02664                                  Name (RefSeq) ubiquitin   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism loa  Loa loa (eye worm) Pathway loa03010   Ribosome loa04120   Ubiquitin mediated proteolysis loa04137   Mitophagy - animal loa04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:loa00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     LOAG_04017   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     LOAG_04017  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     LOAG_04017    04137 Mitophagy - animal     LOAG_04017  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:loa03011]     LOAG_04017    04121 Ubiquitin system [BR:loa04121]     LOAG_04017   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loa04147]     LOAG_04017 Ribosome [BR:loa03011]  Ribosomal proteins   Eukaryotes    Small subunit     LOAG_04017   Archaea     LOAG_04017 Ubiquitin system [BR:loa04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    LOAG_04017 Exosome [BR:loa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LOAG_04017   Exosomal proteins of colorectal cancer cells    LOAG_04017 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 Dsc3_N Plexin_RBD DUF2604 IBR MKLP1_Arf_bdg TBK1_ULD Ubiquitin_5 OTU1_UBXL UBL_UBAC1 Motif Other DBs NCBI-GeneID:  9941413 NCBI-ProteinID:  XP_003139602 UniProt:  A0A1I7VUG5 LinkDB All DBs AA seq 162 aa AA seqDB search MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGGKKRKKKVYTTPKKNKHKRKKVKLAVLKYYKVDENGKITRLRKE CASPSCGGGVFMASHQNRYYCGKCHQTLVMQDPKEKATGKTK NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgcagatattcgtgaagacattaacaggaaaaacgatcacccttgaggtagaatcgtct gacactattgagaatgtgaaagctaaaattcaggataaagaaggcattccgcctgaccaa cagcgacttatttttgcaggtaaacaattggaggatggtcgaacactatcagattataat atccagaaggagtcgacactccaccttgtgttgagattacgaggtggtggcaagaagagg aagaagaaggtttatactacgccgaaaaaaaacaagcataagaggaagaaggtcaaactt gccgtcctgaaatattacaaagtcgatgaaaatggtaaaatcacccgtttacggaaagag tgcgcttcgccatcatgtggtggaggcgttttcatggctagtcatcagaatcgatactat tgcggcaagtgtcatcaaacattggtaatgcaagacccaaaagaaaaagctactggaaag actaaataa

DBGET integrated database retrieval system