Loa loa (eye worm): LOAG_04024 Help Entry LOAG_04024        CDS       T02664                                  Name (RefSeq) hypothetical protein   KO K03873   elongin-B Organism loa  Loa loa (eye worm) Pathway loa04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:loa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     LOAG_04024  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:loa04121]     LOAG_04024    03400 DNA repair and recombination proteins [BR:loa03400]     LOAG_04024 Ubiquitin system [BR:loa04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      LOAG_04024    Cul5 complex      LOAG_04024 DNA repair and recombination proteins [BR:loa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      LOAG_04024 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_4 Motif Other DBs NCBI-GeneID:  9941420 NCBI-ProteinID:  XP_020303181 UniProt:  A0A1S0U4Z5 LinkDB All DBs AA seq 100 aa AA seqDB search MDSSKMELFFEILRRKTHIFCDVKENATVLEIKKIIEGILKDRQTLTECGYTPQNSRAQA PAPLALVVANEEEDVIIEPLSIPPPVPDAMRPEQAATNEQ NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggatagtagtaaaatggaactctttttcgaaatattgcgtcgtaaaacgcatattttt tgcgatgtgaaggaaaatgcaacagttttggaaattaagaaaataattgaaggtatccta aaggatcgtcaaactcttaccgaatgcggttatactcctcagaattctcgtgcccaagca ccggcgccgctagcacttgttgttgctaacgaggaagaggacgttatcattgagccgcta tcaattccaccacctgtaccagatgcaatgaggcctgaacaagccgctacgaatgaacaa tga

DBGET integrated database retrieval system