Loa loa (eye worm): LOAG_10263 Help Entry LOAG_10263        CDS       T02664                                  Name (RefSeq) Ras-like protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism loa  Loa loa (eye worm) Pathway loa04137   Mitophagy - animal loa04140   Autophagy - animal loa04144   Endocytosis loa04145   Phagosome loa04148   Efferocytosis Brite KEGG Orthology (KO) [BR:loa00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     LOAG_10263    04145 Phagosome     LOAG_10263    04140 Autophagy - animal     LOAG_10263    04137 Mitophagy - animal     LOAG_10263    04148 Efferocytosis     LOAG_10263  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:loa04131]     LOAG_10263   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loa04147]     LOAG_10263    04031 GTP-binding proteins [BR:loa04031]     LOAG_10263 Membrane trafficking [BR:loa04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     LOAG_10263 Exosome [BR:loa04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    LOAG_10263   Exosomal proteins of other body fluids (saliva and urine)    LOAG_10263   Exosomal proteins of colorectal cancer cells    LOAG_10263   Exosomal proteins of bladder cancer cells    LOAG_10263 GTP-binding proteins [BR:loa04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     LOAG_10263 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase nSTAND3 AAA_16 cobW ATP_bind_1 Septin AAA_22 AAA_7 PduV-EutP AAA_24 NTPase_1 ATPase_2 NB-ARC SRPRB DAP3 NACHT ATP-synt_ab AAA_14 ABC_tran Motif Other DBs NCBI-GeneID:  9947707 NCBI-ProteinID:  XP_003145838 UniProt:  A0A1I7W5E1 LinkDB All DBs AA seq 212 aa AA seqDB search MSAPGGGRKKALLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKDISVGDRT VTMQIWDTAGQERFQSLGVAFYRGADCCVLTYDITNASSFRSLESWRDEFLIQASPRDPE HFPFVLLGNKIDLEAKRAVSAKRAQAWCQTKNNIKYYEVSAKEAVNVEQAFIEIARDALK REAQDVQDFPEFPDQIRLDHRETTQPTSGCNC NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgtcagcacccggcggtggtcgcaaaaaagctcttcttaaagtaattatactaggtgat tcgggtgttggcaagacatcactaatgaaccaatatgtaaacaagaaattcagtaatcag tataaagcaacgattggtgctgatttcctgacaaaagatatatcagttggtgatcgaact gttactatgcagatttgggacacagctggacaagaacgttttcaatcgttgggtgttgct ttttacagaggagcggattgttgtgtgcttacttatgatatcactaatgccagttctttt agaagccttgaatcatggagagacgaatttttaattcaagcaagtccacgcgatccagaa cattttccattcgtattattgggtaataaaattgatctagaagcgaaacgtgccgttagt gccaaaagagcccaagcatggtgccagacaaaaaacaatatcaaatattatgaggtatcg gctaaggaagctgtgaacgtagagcaagcatttattgaaattgctcgtgatgctttaaag cgcgaagcgcaagatgtgcaggattttccagaatttccggatcagattcgtttggatcac cgggaaacaacacaaccaactagtggttgtaattgctga

DBGET integrated database retrieval system