Loa loa (eye worm): LOAG_11812 Help Entry LOAG_11812        CDS       T02664                                  Name (RefSeq) transporter Sec61 subunit gamma   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism loa  Loa loa (eye worm) Pathway loa03060   Protein export loa04141   Protein processing in endoplasmic reticulum loa04145   Phagosome Brite KEGG Orthology (KO) [BR:loa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     LOAG_11812    04141 Protein processing in endoplasmic reticulum     LOAG_11812  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     LOAG_11812  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:loa04131]     LOAG_11812   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:loa02044]     LOAG_11812 Membrane trafficking [BR:loa04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     LOAG_11812 Secretion system [BR:loa02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    LOAG_11812 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  9949269 NCBI-ProteinID:  XP_003147376 UniProt:  A0A1S0TMW7 LinkDB All DBs AA seq 68 aa AA seqDB search MDHLQALIDPSKQFAKDSIRLVKRCTKPDRKEYQKIAVATAVGFAIMGFIGFFVKLIHIP INNIIVGG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggaccatttacaagcattaattgatccaagcaaacaattcgctaaagattcaattcga ttggtaaaaaggtgcacaaaaccagatcgaaaagaatatcaaaaaattgcagtagcgaca gcagttggttttgctataatgggttttatcggtttcttcgtcaagctgatccatattcca attaataatatcatcgttggtggataa

DBGET integrated database retrieval system