Loa loa (eye worm): LOAG_19111 Help Entry LOAG_19111        CDS       T02664                                  Name (RefSeq) hypothetical protein   KO K09542   crystallin, alpha B Organism loa  Loa loa (eye worm) Pathway loa04141   Protein processing in endoplasmic reticulum loa04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:loa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     LOAG_19111  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     LOAG_19111  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:loa03110]     LOAG_19111   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loa04147]     LOAG_19111 Chaperones and folding catalysts [BR:loa03110]  Heat shock proteins   HSP20    LOAG_19111 Exosome [BR:loa04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    LOAG_19111 SSDB OrthologParalogGFIT Motif Pfam:  HSP20 Motif Other DBs NCBI-GeneID:  31252207 NCBI-ProteinID:  XP_020304430 LinkDB All DBs AA seq 127 aa AA seqDB search MSLFRYNPRDYFYTSPMERFIVNALDSAFGDRSSYRPLQSVAPYWLHQPTLNECNIGNAL GEILDEKDKFRVQIDVSHFHPKELSVSVRDRELSIEGHHKERTDQSGHGSIERHFVRKIC YARRSAT NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgtcacttttccgctataatcctcgcgattatttctatacctcaccgatggaacgtttc atagtaaatgctcttgacagcgcgttcggtgacagatcttcataccgaccgcttcaaagt gtcgcaccatactggctacatcagccgacgttgaacgaatgtaatatcggaaacgcgctt ggcgagatattggatgagaaagacaagtttagagttcaaattgatgtttcccattttcat cccaaggaactttcggtatcggttcgagatcgtgaactaagtattgagggtcatcacaag gagcgtactgatcagtcgggacatggtagtatcgaacgtcacttcgttcggaaaatatgt tatgccagaagaagtgcaacctga

DBGET integrated database retrieval system