Lepisosteus oculatus (spotted gar): 102684181 Help Entry 102684181         CDS       T07349                                  Name (RefSeq) histone H2B 1/2-like   KO K11252   histone H2B Organism loc  Lepisosteus oculatus (spotted gar) Brite KEGG Orthology (KO) [BR:loc00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:loc03036]     102684181   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loc04147]     102684181 Chromosome and associated proteins [BR:loc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102684181 Exosome [BR:loc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102684181 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  102684181 NCBI-ProteinID:  XP_015193337 LinkDB All DBs Position LG26:11776598..11777119 Genome browser AA seq 88 aa AA seqDB search MPEPAKSAPKKGSKKAVTKTAAKGGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKIQTA VRLLLPGELAKHAVSEGTKAVTKYTSSK NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccagcgaaatccgctcctaagaagggatccaagaaagccgtgaccaagacg gccgccaagggcggcaagaagcgcagaaagaccaggaaggagagctacgccatctacgtg tacaaggtgctgaagcaggtgcacccggacaccggcatctcgtcgaagatccagaccgcc gtgcgcctgctgctgcccggagagctggccaagcacgccgtgtccgagggcaccaaggcc gtcaccaagtacaccagctccaagtaa

DBGET integrated database retrieval system