Lepisosteus oculatus (spotted gar): 102684715 Help Entry 102684715         CDS       T07349                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04060   Cytokine-cytokine receptor interaction loc04218   Cellular senescence loc04620   Toll-like receptor signaling pathway loc04621   NOD-like receptor signaling pathway loc04622   RIG-I-like receptor signaling pathway loc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:loc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102684715  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     102684715  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     102684715    04621 NOD-like receptor signaling pathway     102684715    04622 RIG-I-like receptor signaling pathway     102684715  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102684715  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:loc04052]     102684715    00536 Glycosaminoglycan binding proteins [BR:loc00536]     102684715 Cytokines and neuropeptides [BR:loc04052]  Cytokines   Chemokines    102684715 Glycosaminoglycan binding proteins [BR:loc00536]  Heparan sulfate / Heparin   Chemokines    102684715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102684715 NCBI-ProteinID:  XP_006630129 Ensembl:  ENSLOCG00000013350 UniProt:  W5N741 LinkDB All DBs Position LG4:complement(66358292..66360121) Genome browser AA seq 99 aa AA seqDB search MNETRNKMEKKIAFVLFATICAVVTEGVLVRAGEAFRCQCLKTVSQFINPKRLVDIDIIN SGVHCKRVEVIVTLKSGHKVCVDPEAKWVKMIIERLLKK NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaatgaaacaagaaataagatggagaagaagattgcttttgtgctttttgccaccatt tgtgctgtagtaacagaaggtgtcctagtcagagcaggagaggctttccgatgtcagtgc ctgaagactgtctcacagtttatcaaccccaagcgtcttgttgacatcgacataattaat tcaggagtgcactgcaagagggtagaagtcatagtgacacttaaatcaggacacaaagtc tgtgtggatcccgaagccaaatgggtgaagatgattattgaaagactcctgaagaaataa

DBGET integrated database retrieval system