Lepisosteus oculatus (spotted gar): 102685223 Help Entry 102685223         CDS       T07349                                  Symbol hmgb1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc03410   Base excision repair loc04140   Autophagy - animal loc04217   Necroptosis Brite KEGG Orthology (KO) [BR:loc00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     102685223 (hmgb1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102685223 (hmgb1)   09143 Cell growth and death    04217 Necroptosis     102685223 (hmgb1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:loc03036]     102685223 (hmgb1)    03400 DNA repair and recombination proteins [BR:loc03400]     102685223 (hmgb1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loc04147]     102685223 (hmgb1) Chromosome and associated proteins [BR:loc03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     102685223 (hmgb1) DNA repair and recombination proteins [BR:loc03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      102685223 (hmgb1)    MMR (mismatch excision repair)     Other MMR factors      102685223 (hmgb1) Exosome [BR:loc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102685223 (hmgb1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box HMG_box_2 RNA_pol_3_Rpc31 HMG_box_5 Motif Other DBs NCBI-GeneID:  102685223 NCBI-ProteinID:  XP_006643084 Ensembl:  ENSLOCG00000000187 UniProt:  W5LVQ1 LinkDB All DBs Position Unknown AA seq 212 aa AA seqDB search MGKGDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKSKF EDLAKQDKVRYEREMKTYIPPKGEKKKRTKDPNAPKRPPSAFFIFCSDFRPKVKGESPGL SIGDVAKKLGEMWNKTTAEDKQPYEKKAAKLKEKYEKDIAAYRAKGKTDGAKKAPAKMEK AKKKKEEEEEDDDDDDEEEEEEEEEDDEDDDE NT seq 639 nt NT seq  +upstreamnt  +downstreamnt atgggtaaaggcgatcctaagaagcccagaggcaaaatgtcctcgtatgcctacttcgtg cagacctgcagggaggagcacaagaagaaacaccctgatgcctctgtgaatttctccgag ttctccaagaagtgctccgagcgatggaagaccatgtctgccaaagaaaagagcaagttt gaggatttagcaaagcaagacaaggtacgctatgaaagggagatgaaaacctacataccg cccaagggggagaagaagaagaggacaaaagaccctaatgcaccaaaaaggcccccatct gctttcttcatattctgctccgacttccgcccaaaagttaaaggagagagccctggattg tccattggtgatgttgccaagaaattaggggagatgtggaataaaaccaccgctgaggat aagcagccctatgaaaagaaggcagccaagctgaaggagaaatacgaaaaggatatcgcc gcgtaccgtgccaagggcaagaccgatggtgccaagaaagctcctgccaagatggagaag gccaagaagaagaaggaggaggaggaagaggacgacgatgacgacgacgaggaggaagaa gaggaggaggaggaagatgatgaagatgatgatgaataa

DBGET integrated database retrieval system