Lepisosteus oculatus (spotted gar): 102686749 Help Entry 102686749         CDS       T07349                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04081   Hormone signaling loc04144   Endocytosis loc04150   mTOR signaling pathway loc04270   Vascular smooth muscle contraction loc04310   Wnt signaling pathway loc04350   TGF-beta signaling pathway loc04510   Focal adhesion loc04520   Adherens junction loc04530   Tight junction loc04621   NOD-like receptor signaling pathway loc04625   C-type lectin receptor signaling pathway loc04810   Regulation of actin cytoskeleton loc05100   Bacterial invasion of epithelial cells loc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:loc00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102686749    04350 TGF-beta signaling pathway     102686749    04150 mTOR signaling pathway     102686749   09133 Signaling molecules and interaction    04081 Hormone signaling     102686749  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102686749   09144 Cellular community - eukaryotes    04510 Focal adhesion     102686749    04520 Adherens junction     102686749    04530 Tight junction     102686749   09142 Cell motility    04810 Regulation of actin cytoskeleton     102686749  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102686749    04625 C-type lectin receptor signaling pathway     102686749   09153 Circulatory system    04270 Vascular smooth muscle contraction     102686749  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102686749    05100 Bacterial invasion of epithelial cells     102686749  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:loc04131]     102686749   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loc04147]     102686749    04031 GTP-binding proteins [BR:loc04031]     102686749 Membrane trafficking [BR:loc04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     102686749 Exosome [BR:loc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102686749   Exosomal proteins of other body fluids (saliva and urine)    102686749   Exosomal proteins of colorectal cancer cells    102686749   Exosomal proteins of bladder cancer cells    102686749 GTP-binding proteins [BR:loc04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     102686749 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU VASP_tetra Motif Other DBs NCBI-GeneID:  102686749 NCBI-ProteinID:  XP_015203766 Ensembl:  ENSLOCG00000014438 LinkDB All DBs Position LG5:complement(50541591..50553366) Genome browser AA seq 173 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADYDRLRPLSYPDTDVI LMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVK PEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKTSKCLLL NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atggcggcgatccggaagaagctggtgattgtgggggatggcgcgtgcgggaagacctgc ctcctgatcgtcttcagcaaggaccagttccccgaggtgtacgtccccaccgtcttcgag aactacgtggcggactacgaccggctccggcccctctcctaccccgacaccgacgtcatc ctcatgtgcttctccatcgacagcccggacagcttagagaacatccctgaaaagtggacc cccgaggtcaagcacttctgccccaacgttcccatcatcctcgtgggcaacaagaaggac ctgcgcaacgacgagcacacgcgccgcgagctggccaagatgaagcaggagccggtgaag ccggaggagggccgggacatggccaaccgcatcggcgccttcggttacatggagtgctcg gccaagaccaaggacggcgtgcgggaggtcttcgagatggccacacgggcagcgctgcag gcccggcgcgggaagaaaacctctaaatgccttcttttgtaa

DBGET integrated database retrieval system