Lepisosteus oculatus (spotted gar): 102688136 Help Entry 102688136         CDS       T07349                                  Name (RefSeq) histone H2A   KO K11251   histone H2A Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc03082   ATP-dependent chromatin remodeling loc04217   Necroptosis Brite KEGG Orthology (KO) [BR:loc00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102688136  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102688136  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:loc03036]     102688136   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loc04147]     102688136 Chromosome and associated proteins [BR:loc03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102688136 Exosome [BR:loc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102688136 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102688136 NCBI-ProteinID:  XP_006642369 LinkDB All DBs Position LG26:complement(9404782..9406242) Genome browser AA seq 102 aa AA seqDB search MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELELNKLLGGVTIAQGGVLPNIQAVLLPKKTEKPAKSK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtccggcagggggaagaccggcggtaaggccagagcaaaggcgaagtcccgttcctcc agggccgggctacagttcccagtgggccgtgtccaccggctgctgcgcaagggaaactat gccgagcgggtcggcgccggggccccggtgtatctggccgcggtgctggagtacctgacc gccgagatcctggagctggagctgaacaagctgctgggcggcgtgaccatcgcgcagggc ggcgtgctgcccaacatccaggcggtgctgctgcccaagaagaccgagaagccggccaag agcaagtaa

DBGET integrated database retrieval system