Lepisosteus oculatus (spotted gar): 102691846 Help Entry 102691846         CDS       T07349                                  Symbol calml6 Name (RefSeq) calmodulin-like protein 6   KO K02183   calmodulin Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04020   Calcium signaling pathway loc04070   Phosphatidylinositol signaling system loc04114   Oocyte meiosis loc04218   Cellular senescence loc04261   Adrenergic signaling in cardiomyocytes loc04270   Vascular smooth muscle contraction loc04371   Apelin signaling pathway loc04625   C-type lectin receptor signaling pathway loc04744   Phototransduction loc04910   Insulin signaling pathway loc04912   GnRH signaling pathway loc04916   Melanogenesis Brite KEGG Orthology (KO) [BR:loc00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     102691846 (calml6)    04020 Calcium signaling pathway     102691846 (calml6)    04070 Phosphatidylinositol signaling system     102691846 (calml6)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102691846 (calml6)    04218 Cellular senescence     102691846 (calml6)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102691846 (calml6)   09152 Endocrine system    04910 Insulin signaling pathway     102691846 (calml6)    04912 GnRH signaling pathway     102691846 (calml6)    04916 Melanogenesis     102691846 (calml6)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102691846 (calml6)    04270 Vascular smooth muscle contraction     102691846 (calml6)   09157 Sensory system    04744 Phototransduction     102691846 (calml6)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:loc01009]     102691846 (calml6)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:loc04131]     102691846 (calml6)    03036 Chromosome and associated proteins [BR:loc03036]     102691846 (calml6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loc04147]     102691846 (calml6) Protein phosphatases and associated proteins [BR:loc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102691846 (calml6) Membrane trafficking [BR:loc04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102691846 (calml6) Chromosome and associated proteins [BR:loc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102691846 (calml6) Exosome [BR:loc04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102691846 (calml6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 AIF-1 EF-hand_9 EF-hand_5 EH CFAP251_C SAPC2_N EF-hand_EFHB_C ClpS EF-hand_10 EFhand_Ca_insen Motif Other DBs NCBI-GeneID:  102691846 NCBI-ProteinID:  XP_015192724 Ensembl:  ENSLOCG00000006125 UniProt:  W5MG97 LinkDB All DBs Position LG25:complement(11367180..11371332) Genome browser AA seq 156 aa AA seqDB search MVEALTPEQITEYKGVFEMFDEEGNGDVKTSELERLMSLMGINLTKRELVQMAKDVDKDG KGLFNCDSFLGLMALYHERAKNQDAELRAAFKVFDKDAKGYIDWDTLKYVLMNAGEPLNE EEAEQMMKEADKDGDGTIDYEEFVAMMTGDSFKMTS NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggtcgaagccctgactcccgagcagatcacggagtacaaaggcgtgtttgagatgttt gacgaggaggggaacggcgacgtcaagacatcggagctggagagactcatgagcctcatg ggcatcaacctcaccaagagagagctggtgcagatggccaaggatgtagacaaggatggc aagggcctcttcaactgcgacagtttcctgggactgatggcactgtaccacgagagggct aagaaccaggacgcggaactgcgagcggccttcaaagtgttcgataaagatgccaaaggc tatatcgactgggacaccctgaaatacgtgctgatgaacgcaggcgagcccctgaacgag gaggaggccgagcagatgatgaaagaagcagataaggacggggatggaacgattgactac gaagaattcgtggccatgatgacgggtgactcttttaagatgacatcatga

DBGET integrated database retrieval system