Lepisosteus oculatus (spotted gar): 102692303 Help Entry 102692303         CDS       T07349                                  Symbol dynlt3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04814   Motor proteins loc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:loc00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     102692303 (dynlt3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102692303 (dynlt3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:loc03037]     102692303 (dynlt3)    04812 Cytoskeleton proteins [BR:loc04812]     102692303 (dynlt3) Cilium and associated proteins [BR:loc03037]  Motile cilia and associated proteins   Dynein arm    102692303 (dynlt3) Cytoskeleton proteins [BR:loc04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      102692303 (dynlt3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  102692303 NCBI-ProteinID:  XP_006639193 LinkDB All DBs Position LG17:complement(19952496..19959496) Genome browser AA seq 115 aa AA seqDB search MEEYHSSDEVPFNADEASSCVKECIEGIIGGVDYNQNKVNQWTASIVEHSLTQLVKQGKP FKYIVNCAVMQKSGAGLHTANSCYWDTATDGSCTVRWENRTMYCVVSVFAVAVTL NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggaggaataccattccagtgacgaggtcccctttaatgcagatgaagcaagcagctgc gtgaaagagtgtattgaaggtatcattggtggagtagattacaatcagaacaaggtgaat cagtggacagccagtattgttgagcactccctcactcagcttgtcaagcaaggaaaacca ttcaagtacatagtcaactgtgctgtgatgcagaagagtggagctggactacacacagcc aattcctgttactgggacacagctactgatgggagctgcacggtgagatgggagaatcgc accatgtattgtgtggtcagtgtctttgctgttgctgtgaccctctag

DBGET integrated database retrieval system