Lepisosteus oculatus (spotted gar): 102692606 Help Entry 102692606         CDS       T07349                                  Symbol brk1 Name (RefSeq) protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04810   Regulation of actin cytoskeleton loc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:loc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102692606 (brk1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102692606 (brk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CCDC53 Hydro_N_hd DUF7310 SPX Matrilin_ccoil MerR-DNA-bind DUF5617 LXG Motif Other DBs NCBI-GeneID:  102692606 NCBI-ProteinID:  XP_006630743 Ensembl:  ENSLOCG00000010770 UniProt:  W5MXT1 LinkDB All DBs Position LG5:26691535..26694984 Genome browser AA seq 75 aa AA seqDB search MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERR IEYIEARVTKGETLT NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggccggccaggaagatcccgtccagagagagattcaccaagactgggcaaatcgagaa tatatagaagttattaccagcagcattaagaaaatcgcagatttcctcaactcgttcgat atgtcctgtcggtcccgattggcaactctgaatgagaagctgacggcgctggagaggaga attgaatacattgaggctagggttacaaagggggagacattgacttag

DBGET integrated database retrieval system