Lepisosteus oculatus (spotted gar): 102694211 Help Entry 102694211         CDS       T07349                                  Symbol arf4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04144   Endocytosis Brite KEGG Orthology (KO) [BR:loc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102694211 (arf4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:loc04131]     102694211 (arf4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loc04147]     102694211 (arf4)    04031 GTP-binding proteins [BR:loc04031]     102694211 (arf4) Membrane trafficking [BR:loc04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     102694211 (arf4) Exosome [BR:loc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102694211 (arf4)   Exosomal proteins of other body fluids (saliva and urine)    102694211 (arf4)   Exosomal proteins of colorectal cancer cells    102694211 (arf4) GTP-binding proteins [BR:loc04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     102694211 (arf4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K Csa3_N FLAD1_M SRP54 AAA_18 cobW Motif Other DBs NCBI-GeneID:  102694211 NCBI-ProteinID:  XP_006631017 Ensembl:  ENSLOCG00000013270 UniProt:  W5N6U5 LinkDB All DBs Position LG5:41343427..41356090 Genome browser AA seq 180 aa AA seqDB search MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERTQEAAEELQKMLQEDELRDAV LLVFANKQDLPNAMAISEMTDKLGLQALRNRTWYVQATCATQGTGLYEGLDWLSDQLSKR NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atgggcctcaccatttcgagtctcttctcgcgtctcttcgggaagaagcagatgaggata ctgatggttggcctggatgctgcgggtaagaccacgatcctctacaaactgaagctggga gaaatcgtcacaactatccccaccattgggttcaatgtggaaacagtggagtacaagaac atctgcttcacggtgtgggatgtgggtggccaggacaagatcagacccctctggagacac tactttcagaacacacagggtcttatctttgtggtggacagcaatgaccgggagcgaaca caggaagcagcagaggagctgcagaaaatgcttcaagaggacgagctgagagatgcggtg ctgctggtgtttgctaacaaacaggacctgccaaatgctatggccattagcgaaatgaca gataaactgggtctccaggcgttgcgcaacagaacttggtacgtccaagctacctgcgcc acacaggggacgggtctttacgagggactggactggctttccgaccagctctccaaacgc taa

DBGET integrated database retrieval system