Lepisosteus oculatus (spotted gar): 102694874 Help Entry 102694874         CDS       T07349                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04010   MAPK signaling pathway loc04068   FoxO signaling pathway loc04081   Hormone signaling loc04114   Oocyte meiosis loc04140   Autophagy - animal loc04150   mTOR signaling pathway loc04810   Regulation of actin cytoskeleton loc04910   Insulin signaling pathway loc04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:loc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102694874    04068 FoxO signaling pathway     102694874    04150 mTOR signaling pathway     102694874   09133 Signaling molecules and interaction    04081 Hormone signaling     102694874  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102694874   09143 Cell growth and death    04114 Oocyte meiosis     102694874   09142 Cell motility    04810 Regulation of actin cytoskeleton     102694874  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102694874    04914 Progesterone-mediated oocyte maturation     102694874  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:loc04052]     102694874 Cytokines and neuropeptides [BR:loc04052]  Neuropeptides   Unclassified    102694874 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  102694874 NCBI-ProteinID:  XP_006631776 Ensembl:  ENSLOCG00000009877 UniProt:  W5MUL1 LinkDB All DBs Position LG6:23569076..23570859 Genome browser AA seq 111 aa AA seqDB search MARRFQVFSLLALLVLTSPPVTDAAANQHLCGSHLAEALYLVCGERGFTYDPDKMSGTEP GLGLLTGKAGEENVVDEYPFKEQGEMKVKRGIIEQCCHKPCTIYELESYCN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggctcggcggttccaagttttctctctgctcgccctgctggtcctcacttctccaccc gtgactgatgctgcagccaatcagcatctctgcgggtctcacttagcggaagccctgtat ttggtctgcggagagcggggattcacctacgatcccgataaaatgagcggaacggagccg ggacttggtttgctcactggaaaagctggggaggagaatgtagtggacgaatatccattc aaggaacaaggagagatgaaagtgaagagaggcatcattgaacagtgctgccacaagcct tgcaccatatacgaactggaaagttactgcaattaa

DBGET integrated database retrieval system