Lepisosteus oculatus (spotted gar): 102695073 Help Entry 102695073         CDS       T07349                                  Name (RefSeq) insulin-like isoform X2   KO K04526   insulin Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04010   MAPK signaling pathway loc04068   FoxO signaling pathway loc04081   Hormone signaling loc04114   Oocyte meiosis loc04140   Autophagy - animal loc04150   mTOR signaling pathway loc04810   Regulation of actin cytoskeleton loc04910   Insulin signaling pathway loc04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:loc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102695073    04068 FoxO signaling pathway     102695073    04150 mTOR signaling pathway     102695073   09133 Signaling molecules and interaction    04081 Hormone signaling     102695073  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     102695073   09143 Cell growth and death    04114 Oocyte meiosis     102695073   09142 Cell motility    04810 Regulation of actin cytoskeleton     102695073  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     102695073    04914 Progesterone-mediated oocyte maturation     102695073  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:loc04052]     102695073 Cytokines and neuropeptides [BR:loc04052]  Neuropeptides   Unclassified    102695073 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta HdeA Motif Other DBs NCBI-GeneID:  102695073 NCBI-ProteinID:  XP_006631777 Ensembl:  ENSLOCG00000009901 LinkDB All DBs Position LG6:complement(23586902..23633907) Genome browser AA seq 129 aa AA seqDB search MDDVSFQMVKLSGSTGIMALWFQVFSLLALLVLSSPPVTNAAANQHLCGSHLVEALYLVC GEKGFFYNPNKAKRDMEPVLGFLTGKSGQENEVDEYQFKQQGEMKVKRGIVEQCCHKPCT IYELENYCN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggatgatgtgagctttcagatggttaagctctctggcagcactggcattatggctctg tggttccaagttttctctctgctcgccctgcttgtcctgtcttctccacccgtgactaat gctgcagccaatcagcatctctgcgggtctcacttggtggaagctctgtatctagtctgt ggagaaaagggcttcttctacaaccccaacaaagccaagagagacatggaaccagtattg ggtttcctcactggaaaatctggacaggagaatgaagtggacgaatatcaattcaagcaa caaggagagatgaaagtgaagcgaggcatagttgaacagtgctgccacaagccttgcacc atatatgaactggaaaattactgcaattaa

DBGET integrated database retrieval system