Lepisosteus oculatus (spotted gar): 102697398 Help Entry 102697398         CDS       T07349                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04010   MAPK signaling pathway loc04012   ErbB signaling pathway loc04068   FoxO signaling pathway loc04137   Mitophagy - animal loc04140   Autophagy - animal loc04144   Endocytosis loc04150   mTOR signaling pathway loc04210   Apoptosis loc04218   Cellular senescence loc04370   VEGF signaling pathway loc04371   Apelin signaling pathway loc04510   Focal adhesion loc04540   Gap junction loc04625   C-type lectin receptor signaling pathway loc04810   Regulation of actin cytoskeleton loc04910   Insulin signaling pathway loc04912   GnRH signaling pathway loc04916   Melanogenesis loc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:loc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102697398 (hras)    04012 ErbB signaling pathway     102697398 (hras)    04370 VEGF signaling pathway     102697398 (hras)    04371 Apelin signaling pathway     102697398 (hras)    04068 FoxO signaling pathway     102697398 (hras)    04150 mTOR signaling pathway     102697398 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102697398 (hras)    04140 Autophagy - animal     102697398 (hras)    04137 Mitophagy - animal     102697398 (hras)   09143 Cell growth and death    04210 Apoptosis     102697398 (hras)    04218 Cellular senescence     102697398 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102697398 (hras)    04540 Gap junction     102697398 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102697398 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102697398 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     102697398 (hras)    04912 GnRH signaling pathway     102697398 (hras)    04916 Melanogenesis     102697398 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102697398 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:loc04131]     102697398 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loc04147]     102697398 (hras)    04031 GTP-binding proteins [BR:loc04031]     102697398 (hras) Membrane trafficking [BR:loc04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102697398 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     102697398 (hras) Exosome [BR:loc04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102697398 (hras)   Exosomal proteins of colorectal cancer cells    102697398 (hras) GTP-binding proteins [BR:loc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102697398 (hras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  102697398 NCBI-ProteinID:  XP_015193703 Ensembl:  ENSLOCG00000000684 UniProt:  W5LXA0 LinkDB All DBs Position LG27:175788..216960 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMNCKCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagctggtggtggtgggagctggaggcgtggggaagagcgctctgacc atccagctcatccagaaccactttgtggatgagtatgacccaacgatagaggactcctac agaaagcaggttgtgatcgatggggaaacatgtctgctagacatcctggacacagcaggt caagaggagtacagcgccatgagagaccagtacatgaggactggagagggctttctctgt gtgtttgctatcaataacaccaaatccttcgaagacatccatcagtacagggagcagata aagcgggtgaaggattctgacgatgtccccatggtgctggtgggcaacaagtgtgacctc ccggcacggactgtggacacgcggcaggcccaggagctggcccggagttacggcatcccc tacatcgagacgtcggccaagaccagacagggcgtggaagacgcattttacactttggtc cgggagattcgccagcacaaactgcggaagctgaacccccctgatgagagtgggcaggac tgcatgaactgcaagtgtgtggtgtcatga

DBGET integrated database retrieval system