Lepisosteus oculatus (spotted gar): 102697663 Help Entry 102697663         CDS       T07349                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04137   Mitophagy - animal loc04140   Autophagy - animal loc04144   Endocytosis loc04145   Phagosome loc04148   Efferocytosis loc05132   Salmonella infection Brite KEGG Orthology (KO) [BR:loc00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102697663    04145 Phagosome     102697663    04140 Autophagy - animal     102697663    04137 Mitophagy - animal     102697663    04148 Efferocytosis     102697663  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102697663  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:loc04131]     102697663   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:loc04147]     102697663    04031 GTP-binding proteins [BR:loc04031]     102697663 Membrane trafficking [BR:loc04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     102697663 Exosome [BR:loc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102697663   Exosomal proteins of other body fluids (saliva and urine)    102697663   Exosomal proteins of colorectal cancer cells    102697663   Exosomal proteins of bladder cancer cells    102697663 GTP-binding proteins [BR:loc04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     102697663 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin NTPase_1 AAA_7 AAA_16 AAA_22 AAA_24 G-alpha DUF5992 AAA_5 SRPRB ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  102697663 NCBI-ProteinID:  XP_006625649 Ensembl:  ENSLOCG00000015576 LinkDB All DBs Position LG1:11937130..11942782 Genome browser AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNSIPYFETSAKEAINVDQAFQTIARNALKQETEV ETYDFPDQIKLRDDKPTGPNDSCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcgtctcgcaagaaggtgctgttgaaggtgataatcctgggagactcaggggtgggg aagacctctctaatgaaccagtatgtcaacaagaagttcagtaaccagtacaaggccacc atcggcgctgacttcctcaccaaggaggtcatggtggatgatcgcctcgtcaccatgcag atctgggacactgcaggacaagaacggtttcagtccctgggtgtggcattttaccgtgga gcagactgctgcgtgttggtgtttgatgtcacagcgcccaacacctttaagacgctggac agctggcgggatgagttcctgatccaggccagtccccgtgacccagagaacttccccttc gtcgtcctgggcaataagattgacctggagaacaggcaggtaacaacgaaacgtgcccag gcctggtgtcagagcaagaacagcatcccgtacttcgagaccagcgccaaggaggccatc aatgtggaccaggccttccagaccattgcccgcaacgcgctcaaacaggaaacggaagtg gagacctacgacttccccgatcagatcaagctgagagatgacaaacccactggccccaac gattcctgcagctgctga

DBGET integrated database retrieval system