Lepisosteus oculatus (spotted gar): 107077645 Help Entry 107077645         CDS       T07349                                  Name (RefSeq) C-X-C motif chemokine 2-like   KO K12672   C-X-C motif chemokine 11 Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04060   Cytokine-cytokine receptor interaction loc04620   Toll-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:loc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107077645  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107077645  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:loc04052]     107077645 Cytokines and neuropeptides [BR:loc04052]  Cytokines   Chemokines    107077645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107077645 NCBI-ProteinID:  XP_015204934 LinkDB All DBs Position LG6:26251255..26255079 Genome browser AA seq 88 aa AA seqDB search MSCKVVLLVLLAVCIAASAMDVSSSQRCLCIRVRNRLAAVKDIKTIEILPPTSSCEEAEI IVHLKNGIQYCLDPNFKKLLFSLKRRRQ NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtcctgtaaagtggtgctccttgtgctcctggcagtttgcattgctgcctctgcaatg gatgtctcctcgagccaacggtgcctgtgcatcagagtgagaaacaggctggcagctgtc aaggacataaagaccatagagatcctgcctcctacttccagctgtgaagaagcggagatc atagtccatttgaaaaatggaatccagtactgtttggacccaaacttcaagaagcttctt ttcagcctcaaaaggagacgccagtga

DBGET integrated database retrieval system