Leishmania orientalis: 92356855 Help Entry 92356855          CDS       T10351                                  Symbol LSCM4_00853 Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism loi  Leishmania orientalis Pathway loi03020   RNA polymerase loi03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:loi00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     92356855 (LSCM4_00853)   09124 Replication and repair    03420 Nucleotide excision repair     92356855 (LSCM4_00853)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:loi03021]     92356855 (LSCM4_00853)    03400 DNA repair and recombination proteins [BR:loi03400]     92356855 (LSCM4_00853) Transcription machinery [BR:loi03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      92356855 (LSCM4_00853)   RNA polymerase III system    RNA polymerase III      92356855 (LSCM4_00853)   RNA polymerase I system    RNA polymerase I      92356855 (LSCM4_00853) DNA repair and recombination proteins [BR:loi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       92356855 (LSCM4_00853) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 DUF2169 Motif Other DBs NCBI-GeneID:  92356855 NCBI-ProteinID:  XP_067059571 UniProt:  A0A836G957 LinkDB All DBs Position 34:433998..434477 Genome browser AA seq 159 aa AA seqDB search MSDRDDEDDLLSLNLGDGREDGDSGSDIQRSGADEEDEDGGEQLPEDVAANVILSGNAQA AKGARARGITERVTTAVMTKYERARVLGTRALQISMNAPVAVALEGETDPLTIAVKELRE RRTPLIIRRILPDNTYEDWSVSELLVDFDRPADERYTNI NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgtcggaccgcgacgacgaagacgacctcctcagcctaaatctgggcgatggccgtgaa gacggcgatagcggcagcgacatccagcgcagcggcgcggacgaggaagacgaagatgga ggcgagcagctacctgaagacgttgcggccaatgtcatcctgtcgggcaacgcgcaagct gcaaagggtgcgcgggcccgcggcatcaccgagcgcgtgacgactgccgttatgaccaag tatgagcgagcacgtgtgctgggtacgcgcgcgctgcaaattagcatgaatgccccggta gctgtggcgctcgagggtgaaacagatccgctgacgattgccgtgaaagaacttcgggag cgccgcacgccgctgattattcgtcgcatcctgccggacaacacgtacgaggattggagc gttagcgagctactcgtggactttgatcgtccggcggacgagcgctacactaacatctaa

DBGET integrated database retrieval system