Leishmania orientalis: 92360286 Help Entry 92360286          CDS       T10351                                  Symbol LSCM4_04367 Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism loi  Leishmania orientalis Pathway loi04145   Phagocytosis loi04517   IgSF CAM signaling loi04814   Motor proteins Brite KEGG Orthology (KO) [BR:loi00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     92360286 (LSCM4_04367)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     92360286 (LSCM4_04367)   09142 Cell motility    04814 Motor proteins     92360286 (LSCM4_04367)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:loi03037]     92360286 (LSCM4_04367)    04812 Cytoskeleton proteins [BR:loi04812]     92360286 (LSCM4_04367) Cilium and associated proteins [BR:loi03037]  Motile cilia and associated proteins   Dynein arm    92360286 (LSCM4_04367) Cytoskeleton proteins [BR:loi04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      92360286 (LSCM4_04367) SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light N_NLPC_P60 Motif Other DBs NCBI-GeneID:  92360286 NCBI-ProteinID:  XP_067062561 UniProt:  A0A836H3X7 LinkDB All DBs Position 25:complement(<148447..>148716) Genome browser AA seq 89 aa AA seqDB search MSERKPDIKVADISPEMQADALDIASKAIKGHQLEKDMAAHIKREFDKRHFPTWHCIVGR NFGADVEHETKNFIYLYVGQMSVLLWKTA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgagcggaagccggacatcaaggtggcggacatcagtccggagatgcaggcagac gcattagatatcgccagcaaagccattaaggggcatcagctagagaaggatatggcggct catatcaaacgcgagtttgacaagcgccactttccgacgtggcactgcatcgtgggccga aatttcggcgccgatgtcgagcacgagaccaaaaacttcatttacctgtacgttggacag atgtcagtgctactgtggaagacggcgtag

DBGET integrated database retrieval system