Leishmania orientalis: 92360368 Help Entry 92360368          CDS       T10351                                  Symbol LSCM4_04450 Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism loi  Leishmania orientalis Pathway loi03060   Protein export loi04141   Protein processing in endoplasmic reticulum loi04145   Phagosome Brite KEGG Orthology (KO) [BR:loi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     92360368 (LSCM4_04450)    04141 Protein processing in endoplasmic reticulum     92360368 (LSCM4_04450)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     92360368 (LSCM4_04450)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:loi04131]     92360368 (LSCM4_04450)   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:loi02044]     92360368 (LSCM4_04450) Membrane trafficking [BR:loi04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     92360368 (LSCM4_04450) Secretion system [BR:loi02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    92360368 (LSCM4_04450) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  92360368 NCBI-ProteinID:  XP_067062643 UniProt:  A0A836KLB6 LinkDB All DBs Position 25:474088..474297 Genome browser AA seq 69 aa AA seqDB search MEVLDDILFHPIVAFTKNSRMLVRKCQKPNYNEFTTATIAAVIGFLMMGFLGFFVKLVFI PINNVILGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagtcctcgacgacattctgttccaccccattgtggccttcaccaaaaacagccgc atgctggtgcgcaagtgccagaagccaaactacaacgagttcacgacggccaccatcgca gcagtgatcggcttcttgatgatgggctttctcggcttctttgtgaagctggtgttcatc ccgatcaacaacgtcatcctcggggcttag

DBGET integrated database retrieval system