Leishmania orientalis: 92360893 Help Entry 92360893          CDS       T10351                                  Symbol LSCM4_04984 Name (RefSeq) hypothetical protein   KO K12626   U6 snRNA-associated Sm-like protein LSm7 Organism loi  Leishmania orientalis Pathway loi03018   RNA degradation loi03040   Spliceosome Brite KEGG Orthology (KO) [BR:loi00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     92360893 (LSCM4_04984)   09123 Folding, sorting and degradation    03018 RNA degradation     92360893 (LSCM4_04984)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:loi03019]     92360893 (LSCM4_04984)    03041 Spliceosome [BR:loi03041]     92360893 (LSCM4_04984) Messenger RNA biogenesis [BR:loi03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      92360893 (LSCM4_04984)   mRNA degradation factors    5'-3' decay     Lsm complex      92360893 (LSCM4_04984) Spliceosome [BR:loi03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     92360893 (LSCM4_04984) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM Cadherin_2 DUF6800 Motif Other DBs NCBI-GeneID:  92360893 NCBI-ProteinID:  XP_067062262 UniProt:  A0A836KHB0 LinkDB All DBs Position 26:complement(24941..25285) Genome browser AA seq 114 aa AA seqDB search MSPCAVTERQLELRRLNHRVAKIMSAEAAHILKKKEGILSLEKYLDRKVVVSQKGHEVHG VLKGFDNNVNLVLADAELWHRNTRIRTIGACVVRGGPVNLVLSGDVAVIANPFS NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgtctccctgcgcagtcacggagaggcagttggagctgagacgactgaaccatagagtc gcgaagataatgtctgcggaggcggcgcacattctcaagaagaaggagggtattttgtcc ttggagaagtacctcgatcgtaaagtcgtggtttcccagaaaggccacgaagtccacggc gtcttaaaagggtttgacaataatgtaaacttggttcttgccgacgcagagctttggcac cgcaacacgcgcatccgcaccatcggcgcttgcgttgtgcgcggtggtcctgtaaatctc gtcctctccggtgacgttgctgtgattgcaaaccccttctcttag

DBGET integrated database retrieval system