Leishmania orientalis: 92363856 Help Entry 92363856          CDS       T10351                                  Symbol LSCM4_08046 Name (RefSeq) hypothetical protein   KO K10420   dynein light chain Tctex-type 1/3 Organism loi  Leishmania orientalis Pathway loi04145   Phagocytosis loi04814   Motor proteins Brite KEGG Orthology (KO) [BR:loi00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     92363856 (LSCM4_08046)   09142 Cell motility    04814 Motor proteins     92363856 (LSCM4_08046)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:loi03037]     92363856 (LSCM4_08046)    04812 Cytoskeleton proteins [BR:loi04812]     92363856 (LSCM4_08046) Cilium and associated proteins [BR:loi03037]  Motile cilia and associated proteins   Dynein arm    92363856 (LSCM4_08046) Cytoskeleton proteins [BR:loi04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      92363856 (LSCM4_08046) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 NOMO_6th DUF5775 Motif Other DBs NCBI-GeneID:  92363856 NCBI-ProteinID:  XP_067065889 UniProt:  A0A836I056 LinkDB All DBs Position 5:<208284..>208619 Genome browser AA seq 111 aa AA seqDB search MASADRITLVDDASVICEDVVNSLFNHETRYQHHKVAGLVSAISDQVVQRLTQEAKLPRK YVVLVTILQKNGAGVQMISSCSWNPTSDACYVYTAENKAMHCIITVYGVTV NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggcctccgccgatcgcatcacattggtcgacgacgcctccgttatctgcgaagacgtc gtcaactctctcttcaaccatgaaacgcgctaccagcaccacaaggtcgctggcctcgtc tccgccatctccgatcaggtggtgcagcggttgacgcaggaagcgaagctgccgcgcaag tacgttgtcctcgtcaccatcctgcagaagaatggtgctggcgtgcagatgatctcgtcg tgctcctggaaccccacgagcgacgcgtgttacgtatacacagcggaaaataaagccatg cattgcatcatcacggtctacggcgtcactgtgtag

DBGET integrated database retrieval system